Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147807.1 | 5prime_partial | 101 | 1-306(+) |
Amino Acid sequence : | |||
ARGKYNMFVAQIVCAALGVMALSILGPGSLARATAVAASVAFMIITGATHPPAASLPILFIDGAKFHHLSLWYALFPGATSCVLLCVIQEMVIYLKNNYKF* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,729.758 | ||
Theoretical pI: | 9.223 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 23.885 | ||
aromaticity | 0.109 | ||
GRAVY | 0.936 | ||
Secondary Structure Fraction | |||
Helix | 0.386 | ||
turn | 0.208 | ||
sheet | 0.337 |