Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147809.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
TRQVSRVARQMIERFGFSKKIGQVAIGSSGGDPFLGQQMSSQKDYSMATADIVDAEVRELVEKAYFRAKEILTTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELYVA* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,442.116 | ||
Theoretical pI: | 5.364 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 47.513 | ||
aromaticity | 0.081 | ||
GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.153 | ||
sheet | 0.297 |