Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147818.1 | complete | 147 | 211-654(+) |
Amino Acid sequence : | |||
MIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGCRNRRMDFIYEDELNNFLEKGALSELVVAFSREGPTKEYVQHKMAEKASEIWNVISKGGYIYVCGDAKGMAKDVHRVLHTIAQE QGSLDSSKAESLVKSLQTEGRYLRDVW* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 11,857.436 | ||
Theoretical pI: | 9.119 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 46.322 | ||
aromaticity | 0.117 | ||
GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.282 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147818.1 | complete | 103 | 39-350(+) |
Amino Acid sequence : | |||
MCFGSWTNTHGKNSQRNLLNMDEECSSTVGKPKLQLGSCICETIKFQTSFRSIYSYYYDWSWHRVGTLQGLLAGKVGIEGRRCRAWPSHSLLWMQEPKNGLHL* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,857.436 | ||
Theoretical pI: | 9.119 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 46.322 | ||
aromaticity | 0.117 | ||
GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.282 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147818.1 | complete | 147 | 211-654(+) |
Amino Acid sequence : | |||
MIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGCRNRRMDFIYEDELNNFLEKGALSELVVAFSREGPTKEYVQHKMAEKASEIWNVISKGGYIYVCGDAKGMAKDVHRVLHTIAQE QGSLDSSKAESLVKSLQTEGRYLRDVW* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 11,857.436 | ||
Theoretical pI: | 9.119 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 46.322 | ||
aromaticity | 0.117 | ||
GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.282 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147818.1 | complete | 103 | 39-350(+) |
Amino Acid sequence : | |||
MCFGSWTNTHGKNSQRNLLNMDEECSSTVGKPKLQLGSCICETIKFQTSFRSIYSYYYDWSWHRVGTLQGLLAGKVGIEGRRCRAWPSHSLLWMQEPKNGLHL* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,857.436 | ||
Theoretical pI: | 9.119 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 46.322 | ||
aromaticity | 0.117 | ||
GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.282 | ||
sheet | 0.204 |