| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147818.1 | complete | 147 | 211-654(+) |
Amino Acid sequence : | |||
| MIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGCRNRRMDFIYEDELNNFLEKGALSELVVAFSREGPTKEYVQHKMAEKASEIWNVISKGGYIYVCGDAKGMAKDVHRVLHTIAQE QGSLDSSKAESLVKSLQTEGRYLRDVW* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 11,857.436 | ||
| Theoretical pI: | 9.119 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 46.322 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147818.1 | complete | 103 | 39-350(+) |
Amino Acid sequence : | |||
| MCFGSWTNTHGKNSQRNLLNMDEECSSTVGKPKLQLGSCICETIKFQTSFRSIYSYYYDWSWHRVGTLQGLLAGKVGIEGRRCRAWPSHSLLWMQEPKNGLHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,857.436 | ||
| Theoretical pI: | 9.119 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 46.322 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147818.1 | complete | 147 | 211-654(+) |
Amino Acid sequence : | |||
| MIGPGTGLAPFRGFLQERLALREEGAELGPATLFFGCRNRRMDFIYEDELNNFLEKGALSELVVAFSREGPTKEYVQHKMAEKASEIWNVISKGGYIYVCGDAKGMAKDVHRVLHTIAQE QGSLDSSKAESLVKSLQTEGRYLRDVW* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 11,857.436 | ||
| Theoretical pI: | 9.119 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 46.322 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147818.1 | complete | 103 | 39-350(+) |
Amino Acid sequence : | |||
| MCFGSWTNTHGKNSQRNLLNMDEECSSTVGKPKLQLGSCICETIKFQTSFRSIYSYYYDWSWHRVGTLQGLLAGKVGIEGRRCRAWPSHSLLWMQEPKNGLHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,857.436 | ||
| Theoretical pI: | 9.119 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 46.322 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.204 | ||