Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147823.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
ARAPVEFGSLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQDYEKSGEYTGFPTL GVEWQKMENPDLRKAMGMLPNQKGVRIRRIEPTAPEFQFLKSSDIILSFDGVDIANDGTVPFRHGERI | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 20,379.917 | ||
Theoretical pI: | 5.052 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 40.523 | ||
aromaticity | 0.080 | ||
GRAVY | -0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.282 | ||
sheet | 0.213 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147823.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
ARAPVEFGSLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQDYEKSGEYTGFPTL GVEWQKMENPDLRKAMGMLPNQKGVRIRRIEPTAPEFQFLKSSDIILSFDGVDIANDGTVPFRHGERI | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 20,379.917 | ||
Theoretical pI: | 5.052 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 40.523 | ||
aromaticity | 0.080 | ||
GRAVY | -0.103 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.282 | ||
sheet | 0.213 |