| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147823.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
| ARAPVEFGSLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQDYEKSGEYTGFPTL GVEWQKMENPDLRKAMGMLPNQKGVRIRRIEPTAPEFQFLKSSDIILSFDGVDIANDGTVPFRHGERI | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,379.917 | ||
| Theoretical pI: | 5.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 40.523 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.282 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147823.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
| ARAPVEFGSLPALQDAVTVVGYPIGGDTISVTSGVVSRMEILSYVHGSTELLGLQIDAAINSGNSGGPAFNDKGKCVGIAFQSLKHEDVENIGYVIPTPVIMHFIQDYEKSGEYTGFPTL GVEWQKMENPDLRKAMGMLPNQKGVRIRRIEPTAPEFQFLKSSDIILSFDGVDIANDGTVPFRHGERI | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,379.917 | ||
| Theoretical pI: | 5.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 40.523 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.103 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.282 | ||
| sheet | 0.213 | ||