| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147828.1 | 5prime_partial | 115 | 2-349(+) |
Amino Acid sequence : | |||
| HEVPEKAKMGTELKLGSSKPMIATQEEMTENKVPIPYRDQCAHILIPLNKCRQKELYLPWKCENERHSYEKCEYELVMERLLQMQKIREMQEEKKKAVRIQGGKIPLIPSTANAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,438.593 | ||
| Theoretical pI: | 8.667 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 37.749 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.813 | ||
Secondary Structure Fraction | |||
| Helix | 0.235 | ||
| turn | 0.183 | ||
| sheet | 0.330 | ||