Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147828.1 | 5prime_partial | 115 | 2-349(+) |
Amino Acid sequence : | |||
HEVPEKAKMGTELKLGSSKPMIATQEEMTENKVPIPYRDQCAHILIPLNKCRQKELYLPWKCENERHSYEKCEYELVMERLLQMQKIREMQEEKKKAVRIQGGKIPLIPSTANAS* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,438.593 | ||
Theoretical pI: | 8.667 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 37.749 | ||
aromaticity | 0.043 | ||
GRAVY | -0.813 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.183 | ||
sheet | 0.330 |