| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147833.1 | internal | 106 | 3-320(+) |
Amino Acid sequence : | |||
| NAIFYCKLYQIRYHDNAFLACRALHIASKLNASATYNLLQSFFDFQERYYNSMTNRMSRASITDDMAKFAASSIGESLLPMFQSGFKDTNTDSATKTSFKYGCLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,074.535 | ||
| Theoretical pI: | 9.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 41.053 | ||
| aromaticity | 0.151 | ||
| GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.226 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147833.1 | internal | 106 | 3-320(+) |
Amino Acid sequence : | |||
| NAIFYCKLYQIRYHDNAFLACRALHIASKLNASATYNLLQSFFDFQERYYNSMTNRMSRASITDDMAKFAASSIGESLLPMFQSGFKDTNTDSATKTSFKYGCLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,074.535 | ||
| Theoretical pI: | 9.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 41.053 | ||
| aromaticity | 0.151 | ||
| GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.226 | ||
| sheet | 0.255 | ||