| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147841.1 | internal | 169 | 1-507(+) |
Amino Acid sequence : | |||
| ARVYGRLFPQSSVHFIHSSYSLHWLSQVPQGLKSDTGLPLNKRNIYIAKSSPQIVAESYLKQFQMDFSAFLRSRFEELVTGGRMVLIFLGRMTKAPCGELSSCFGLLADALNAMVLEGIM NEAKVEDFNLPIYAASMEEVMTIVETIGLFHVEQVEIFETNWDPFDDSS | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 19,050.648 | ||
| Theoretical pI: | 5.029 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 48.369 | ||
| aromaticity | 0.112 | ||
| GRAVY | 0.065 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.237 | ||
| sheet | 0.290 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147841.1 | internal | 169 | 1-507(+) |
Amino Acid sequence : | |||
| ARVYGRLFPQSSVHFIHSSYSLHWLSQVPQGLKSDTGLPLNKRNIYIAKSSPQIVAESYLKQFQMDFSAFLRSRFEELVTGGRMVLIFLGRMTKAPCGELSSCFGLLADALNAMVLEGIM NEAKVEDFNLPIYAASMEEVMTIVETIGLFHVEQVEIFETNWDPFDDSS | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 19,050.648 | ||
| Theoretical pI: | 5.029 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 48.369 | ||
| aromaticity | 0.112 | ||
| GRAVY | 0.065 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.237 | ||
| sheet | 0.290 | ||