Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147847.1 | 5prime_partial | 178 | 3-539(+) |
Amino Acid sequence : | |||
HEQTRAGQRTRFKAFVVVGDNNGHVGLGVKCAKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDVFTSSRGSTKT LGNFVKATFDCLMKTYGFLTPDLWMETRFVKSPYQEYTDLLAKPIAKAIVEEPDKLEG* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,318.390 | ||
Theoretical pI: | 9.905 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
Instability index: | 18.892 | ||
aromaticity | 0.079 | ||
GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.213 | ||
sheet | 0.208 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147847.1 | 5prime_partial | 178 | 3-539(+) |
Amino Acid sequence : | |||
HEQTRAGQRTRFKAFVVVGDNNGHVGLGVKCAKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGAGIVAARVPKKVLQFAGIDDVFTSSRGSTKT LGNFVKATFDCLMKTYGFLTPDLWMETRFVKSPYQEYTDLLAKPIAKAIVEEPDKLEG* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,318.390 | ||
Theoretical pI: | 9.905 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
Instability index: | 18.892 | ||
aromaticity | 0.079 | ||
GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.213 | ||
sheet | 0.208 |