| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147850.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
| VKVVIIERLTTKTPFRVPSAAICYPFPFPSGKMQGAMQAIRSRGNVLRHTVLQHVRVLNPIVRPTIFSRSESVSSARLEEHGFESTTISDILKSKGKSADGSWLWCTTEDTVYNAVKSMT QHNVGALVVVKSGEEKSVAGIITERDYLRKIIVQGRSSKSTMVGDIMT | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,535.241 | ||
| Theoretical pI: | 9.892 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 46.993 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.244 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147850.1 | internal | 168 | 3-506(+) |
Amino Acid sequence : | |||
| VKVVIIERLTTKTPFRVPSAAICYPFPFPSGKMQGAMQAIRSRGNVLRHTVLQHVRVLNPIVRPTIFSRSESVSSARLEEHGFESTTISDILKSKGKSADGSWLWCTTEDTVYNAVKSMT QHNVGALVVVKSGEEKSVAGIITERDYLRKIIVQGRSSKSTMVGDIMT | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,535.241 | ||
| Theoretical pI: | 9.892 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 46.993 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.244 | ||
| sheet | 0.190 | ||