Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147867.1 | internal | 200 | 602-3(-) |
Amino Acid sequence : | |||
QHIYLFLRHTTHKRGNNQPQDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSF LIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIVLICLVN | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 19,054.397 | ||
Theoretical pI: | 8.160 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 56.106 | ||
aromaticity | 0.084 | ||
GRAVY | -0.638 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.234 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147867.1 | 5prime_partial | 167 | 1-504(+) |
Amino Acid sequence : | |||
ALTKQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSG KFLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 19,054.397 | ||
Theoretical pI: | 8.160 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 56.106 | ||
aromaticity | 0.084 | ||
GRAVY | -0.638 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.234 | ||
sheet | 0.228 |