Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147883.1 | internal | 194 | 2-583(+) |
Amino Acid sequence : | |||
NEGFYFNDQETDPTMGKSYPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVE ITGGPDVPFHPGREDKPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLGRCHKDRSGFEGAWT | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 14,977.148 | ||
Theoretical pI: | 10.004 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 44.233 | ||
aromaticity | 0.038 | ||
GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.231 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147883.1 | 3prime_partial | 130 | 391-2(-) |
Amino Acid sequence : | |||
MERDIRASSNFHSNNTSKLIKISIGDDRELLLDRFQEPDGNIKTIVRSVSELRLMPHRPERTSGLRLTIESSGRVPCYSEHQRSTVLLGDKSTELPLALLHRLEVLRAHGRVRLPHRRIC FLIVEIKSFV | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,977.148 | ||
Theoretical pI: | 10.004 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 44.233 | ||
aromaticity | 0.038 | ||
GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.231 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147883.1 | internal | 194 | 2-583(+) |
Amino Acid sequence : | |||
NEGFYFNDQETDPTMGKSYPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVE ITGGPDVPFHPGREDKPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLGRCHKDRSGFEGAWT | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 14,977.148 | ||
Theoretical pI: | 10.004 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 44.233 | ||
aromaticity | 0.038 | ||
GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.231 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147883.1 | 3prime_partial | 130 | 391-2(-) |
Amino Acid sequence : | |||
MERDIRASSNFHSNNTSKLIKISIGDDRELLLDRFQEPDGNIKTIVRSVSELRLMPHRPERTSGLRLTIESSGRVPCYSEHQRSTVLLGDKSTELPLALLHRLEVLRAHGRVRLPHRRIC FLIVEIKSFV | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,977.148 | ||
Theoretical pI: | 10.004 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 44.233 | ||
aromaticity | 0.038 | ||
GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.231 | ||
sheet | 0.254 |