Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147893.1 | 3prime_partial | 192 | 48-623(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSP | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 20,082.950 | ||
Theoretical pI: | 7.634 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 25.955 | ||
aromaticity | 0.047 | ||
GRAVY | 0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.260 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147893.1 | 3prime_partial | 192 | 48-623(+) |
Amino Acid sequence : | |||
MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSP | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 20,082.950 | ||
Theoretical pI: | 7.634 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 25.955 | ||
aromaticity | 0.047 | ||
GRAVY | 0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.260 | ||
sheet | 0.229 |