Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147903.1 | 5prime_partial | 107 | 1-324(+) |
Amino Acid sequence : | |||
NNLGTIARSGTKEFMEALTAGADVSMIGQIGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVSRDSGENLGRGTKITLYLKEDQVWTSRHTVLNFLSMLTV* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,752.037 | ||
Theoretical pI: | 5.236 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 21.264 | ||
aromaticity | 0.093 | ||
GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.234 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147903.1 | 5prime_partial | 107 | 1-324(+) |
Amino Acid sequence : | |||
NNLGTIARSGTKEFMEALTAGADVSMIGQIGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVSRDSGENLGRGTKITLYLKEDQVWTSRHTVLNFLSMLTV* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 11,752.037 | ||
Theoretical pI: | 5.236 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 21.264 | ||
aromaticity | 0.093 | ||
GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.234 | ||
sheet | 0.243 |