| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147949.1 | internal | 174 | 2-523(+) |
Amino Acid sequence : | |||
| PLLNHSATAIDACSVDVDPGRPAPLAWQRKLDEEENKLSEFTLNMTGKIAMAPFIFQLCRNYIKETARGRAAIYNPFKKVALTSHGIPLGGIGAGSIKRSYEGYFQQLQLFPETCEEIPV LANQFSVFISRPNGKQYSTVLSPRSADIPKGSSNPGIESWDWNLNGQSSTYYGL | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,201.523 | ||
| Theoretical pI: | 8.171 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 42.579 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.333 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.305 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147949.1 | internal | 174 | 2-523(+) |
Amino Acid sequence : | |||
| PLLNHSATAIDACSVDVDPGRPAPLAWQRKLDEEENKLSEFTLNMTGKIAMAPFIFQLCRNYIKETARGRAAIYNPFKKVALTSHGIPLGGIGAGSIKRSYEGYFQQLQLFPETCEEIPV LANQFSVFISRPNGKQYSTVLSPRSADIPKGSSNPGIESWDWNLNGQSSTYYGL | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 19,201.523 | ||
| Theoretical pI: | 8.171 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 42.579 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.333 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.305 | ||
| sheet | 0.236 | ||