| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147951.1 | internal | 153 | 1-459(+) |
Amino Acid sequence : | |||
| QNLERAVKENDRVYLMRVPAPGSLSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQASEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVEAV QISGGPSGLEAEIQQLRDLRRVNQELLVQTEEL | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,892.104 | ||
| Theoretical pI: | 4.672 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 36.609 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.203 | ||
| sheet | 0.359 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147951.1 | internal | 153 | 1-459(+) |
Amino Acid sequence : | |||
| QNLERAVKENDRVYLMRVPAPGSLSALPSASLVKSVPMAEVLDASKERLFTGIVPDTSAKALSRYTEMVDDVIRTQAEKLQQASEITRVKLKEMDLPDSVLALEGSFSLPMDLKEDVEAV QISGGPSGLEAEIQQLRDLRRVNQELLVQTEEL | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,892.104 | ||
| Theoretical pI: | 4.672 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 36.609 | ||
| aromaticity | 0.026 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.203 | ||
| sheet | 0.359 | ||