| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147955.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
| ASSVEGVDVKLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGY TFGAGMFEMEEVKGGSPYGSGTFAGDGSRT | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 10,447.078 | ||
| Theoretical pI: | 8.228 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
| Instability index: | 72.410 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.229 | ||
| turn | 0.400 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147955.1 | 3prime_partial | 105 | 315-1(-) |
Amino Acid sequence : | |||
| MAVNAVVSCPPPCDPVLKNIPAGFPASCCALQSPPVASRKALNCAAIMPNLVGNPKINPSASASSFGVMIGTSLLGGALIFPSMSSCRVSGTCHSLTSTPSTDDA | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 10,447.078 | ||
| Theoretical pI: | 8.228 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
| Instability index: | 72.410 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.229 | ||
| turn | 0.400 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147955.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
| ASSVEGVDVKLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAITQLTHHGMIFVPIGY TFGAGMFEMEEVKGGSPYGSGTFAGDGSRT | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 10,447.078 | ||
| Theoretical pI: | 8.228 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
| Instability index: | 72.410 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.229 | ||
| turn | 0.400 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147955.1 | 3prime_partial | 105 | 315-1(-) |
Amino Acid sequence : | |||
| MAVNAVVSCPPPCDPVLKNIPAGFPASCCALQSPPVASRKALNCAAIMPNLVGNPKINPSASASSFGVMIGTSLLGGALIFPSMSSCRVSGTCHSLTSTPSTDDA | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 10,447.078 | ||
| Theoretical pI: | 8.228 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
| Instability index: | 72.410 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.229 | ||
| turn | 0.400 | ||
| sheet | 0.238 | ||