Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147957.1 | internal | 152 | 3-458(+) |
Amino Acid sequence : | |||
ANSSAMANLRRTLPLLHKTLNLTPSISQPFLHRSRIGAISRFSSDHGSLEFDMSNEENKRQLHNRLLYRSRQRGLLELDLVLGNWVAENIRSMDKHRIKALVDVLDLENPDLWSWLTGQE QPPEAVNNNPVFAAVRSKVAENLNHAAPETRA | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,266.328 | ||
Theoretical pI: | 9.298 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 61.557 | ||
aromaticity | 0.053 | ||
GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.270 | ||
sheet | 0.316 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147957.1 | internal | 152 | 3-458(+) |
Amino Acid sequence : | |||
ANSSAMANLRRTLPLLHKTLNLTPSISQPFLHRSRIGAISRFSSDHGSLEFDMSNEENKRQLHNRLLYRSRQRGLLELDLVLGNWVAENIRSMDKHRIKALVDVLDLENPDLWSWLTGQE QPPEAVNNNPVFAAVRSKVAENLNHAAPETRA | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,266.328 | ||
Theoretical pI: | 9.298 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 61.557 | ||
aromaticity | 0.053 | ||
GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.270 | ||
sheet | 0.316 |