| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147957.1 | internal | 152 | 3-458(+) |
Amino Acid sequence : | |||
| ANSSAMANLRRTLPLLHKTLNLTPSISQPFLHRSRIGAISRFSSDHGSLEFDMSNEENKRQLHNRLLYRSRQRGLLELDLVLGNWVAENIRSMDKHRIKALVDVLDLENPDLWSWLTGQE QPPEAVNNNPVFAAVRSKVAENLNHAAPETRA | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,266.328 | ||
| Theoretical pI: | 9.298 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 61.557 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.270 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147957.1 | internal | 152 | 3-458(+) |
Amino Acid sequence : | |||
| ANSSAMANLRRTLPLLHKTLNLTPSISQPFLHRSRIGAISRFSSDHGSLEFDMSNEENKRQLHNRLLYRSRQRGLLELDLVLGNWVAENIRSMDKHRIKALVDVLDLENPDLWSWLTGQE QPPEAVNNNPVFAAVRSKVAENLNHAAPETRA | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,266.328 | ||
| Theoretical pI: | 9.298 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 61.557 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.534 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.270 | ||
| sheet | 0.316 | ||