Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147960.1 | 5prime_partial | 172 | 2-520(+) |
Amino Acid sequence : | |||
GTLRMLELIVELLPQFASAIEILKGDGGTGTVIRIAMNNAPGASGPVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASL AMIAKAIVKHLLENEKEGCMKVMSSKLCFDYKLWFKRLFQSKARGVKISDAM* | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 18,982.853 | ||
Theoretical pI: | 5.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 38.453 | ||
aromaticity | 0.070 | ||
GRAVY | 0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.180 | ||
sheet | 0.314 |