Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147969.1 | internal | 177 | 533-3(-) |
Amino Acid sequence : | |||
QDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQS MRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIAL | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 18,623.858 | ||
Theoretical pI: | 6.748 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 54.204 | ||
aromaticity | 0.086 | ||
GRAVY | -0.666 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.245 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147969.1 | 5prime_partial | 163 | 1-492(+) |
Amino Acid sequence : | |||
SKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLR RFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 18,623.858 | ||
Theoretical pI: | 6.748 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 54.204 | ||
aromaticity | 0.086 | ||
GRAVY | -0.666 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.245 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147969.1 | internal | 177 | 533-3(-) |
Amino Acid sequence : | |||
QDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQS MRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIAL | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 18,623.858 | ||
Theoretical pI: | 6.748 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 54.204 | ||
aromaticity | 0.086 | ||
GRAVY | -0.666 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.245 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147969.1 | 5prime_partial | 163 | 1-492(+) |
Amino Acid sequence : | |||
SKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLR RFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 18,623.858 | ||
Theoretical pI: | 6.748 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 54.204 | ||
aromaticity | 0.086 | ||
GRAVY | -0.666 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.245 | ||
sheet | 0.233 |