Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147990.1 | 5prime_partial | 135 | 3-410(+) |
Amino Acid sequence : | |||
KMAGEKVYHFDEVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILI LVLAFGVRHFTKVEE* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 15,042.887 | ||
Theoretical pI: | 5.272 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 31.080 | ||
aromaticity | 0.096 | ||
GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.215 | ||
sheet | 0.215 |