| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147992.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
| ATVTVSTPFSIVAFTRSSFAFSGSRNLRVNFPLLLSTRCHRDSSSSSSFSFLLSPLIWRTLPSSTSTFTSSFLIPGRSTLNTCALGVSFQSTRVLARAEVSPGKLRLGVEVDRKSWRNGQ RSKGSHRSRDKGSRMLLGREPNPNPN | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 15,980.989 | ||
| Theoretical pI: | 5.438 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 64.000 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.255 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147992.1 | internal | 145 | 2-436(+) |
Amino Acid sequence : | |||
| FGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERRKEKDEEEEESRWHRVERSSGKFTRR FRLPENAKLDRVKATMENGVLTVTV | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,980.989 | ||
| Theoretical pI: | 5.438 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 64.000 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.255 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147992.1 | internal | 145 | 436-2(-) |
Amino Acid sequence : | |||
| HSDSEHSVLHRSLHPIQFRILRQPESSRKLSAAPLDPVPPGLLLLLVLLLSPLAADLEDSPLLHLDLHLLLLDPREVDPEHVRPGRLLPVHTCVGQSGGLAGEVETRSGSRQEVVEERTA IEGVPQVERQGVKDVAWSRTQPEPE | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,980.989 | ||
| Theoretical pI: | 5.438 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 64.000 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.255 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147992.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
| ATVTVSTPFSIVAFTRSSFAFSGSRNLRVNFPLLLSTRCHRDSSSSSSFSFLLSPLIWRTLPSSTSTFTSSFLIPGRSTLNTCALGVSFQSTRVLARAEVSPGKLRLGVEVDRKSWRNGQ RSKGSHRSRDKGSRMLLGREPNPNPN | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 15,980.989 | ||
| Theoretical pI: | 5.438 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 64.000 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.255 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147992.1 | internal | 145 | 2-436(+) |
Amino Acid sequence : | |||
| FGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERRKEKDEEEEESRWHRVERSSGKFTRR FRLPENAKLDRVKATMENGVLTVTV | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,980.989 | ||
| Theoretical pI: | 5.438 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 64.000 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.255 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147992.1 | internal | 145 | 436-2(-) |
Amino Acid sequence : | |||
| HSDSEHSVLHRSLHPIQFRILRQPESSRKLSAAPLDPVPPGLLLLLVLLLSPLAADLEDSPLLHLDLHLLLLDPREVDPEHVRPGRLLPVHTCVGQSGGLAGEVETRSGSRQEVVEERTA IEGVPQVERQGVKDVAWSRTQPEPE | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,980.989 | ||
| Theoretical pI: | 5.438 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 64.000 | ||
| aromaticity | 0.014 | ||
| GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.255 | ||
| sheet | 0.324 | ||