Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147998.1 | internal | 137 | 3-413(+) |
Amino Acid sequence : | |||
TSGTFSVPRLKSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFR QIMAHFSDVAEAYIEKR | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,771.984 | ||
Theoretical pI: | 5.574 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 34.676 | ||
aromaticity | 0.095 | ||
GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.204 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX147998.1 | internal | 137 | 3-413(+) |
Amino Acid sequence : | |||
TSGTFSVPRLKSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFR QIMAHFSDVAEAYIEKR | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,771.984 | ||
Theoretical pI: | 5.574 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
Instability index: | 34.676 | ||
aromaticity | 0.095 | ||
GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.204 | ||
sheet | 0.270 |