| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147998.1 | internal | 137 | 3-413(+) |
Amino Acid sequence : | |||
| TSGTFSVPRLKSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFR QIMAHFSDVAEAYIEKR | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,771.984 | ||
| Theoretical pI: | 5.574 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 34.676 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.204 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX147998.1 | internal | 137 | 3-413(+) |
Amino Acid sequence : | |||
| TSGTFSVPRLKSLASKMRVPKYEKKLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFR QIMAHFSDVAEAYIEKR | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,771.984 | ||
| Theoretical pI: | 5.574 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22460 | ||
| Instability index: | 34.676 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.204 | ||
| sheet | 0.270 | ||