| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148001.1 | internal | 175 | 2-526(+) |
Amino Acid sequence : | |||
| PDIVAEYDYIFLWDEDLGVEHFNPDRYLSIIRREGLEISQPGLDTSKSQLHYRITARRGKGDVHRRIYQFHGGKRCYENSTAPPCTGWVEMMAPVFSRAAWRCVWHMIQNDLIHAWGLDK KLGYCAQGDRSKTVGVVDSEYIVHKGLPTLGGVDESRGSSGSHTNKDRFAVRQRS | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 19,996.284 | ||
| Theoretical pI: | 8.497 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39670 | ||
| Instability index: | 41.551 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.605 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.234 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148001.1 | internal | 175 | 2-526(+) |
Amino Acid sequence : | |||
| PDIVAEYDYIFLWDEDLGVEHFNPDRYLSIIRREGLEISQPGLDTSKSQLHYRITARRGKGDVHRRIYQFHGGKRCYENSTAPPCTGWVEMMAPVFSRAAWRCVWHMIQNDLIHAWGLDK KLGYCAQGDRSKTVGVVDSEYIVHKGLPTLGGVDESRGSSGSHTNKDRFAVRQRS | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 19,996.284 | ||
| Theoretical pI: | 8.497 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39670 | ||
| Instability index: | 41.551 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.605 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.234 | ||
| sheet | 0.183 | ||