| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148005.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
| ALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQRW GQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 12,677.945 | ||
| Theoretical pI: | 9.647 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 58.142 | ||
| aromaticity | 0.018 | ||
| GRAVY | -1.288 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.286 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148005.1 | 5prime_partial | 112 | 2-340(+) |
Amino Acid sequence : | |||
| GADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,677.945 | ||
| Theoretical pI: | 9.647 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 58.142 | ||
| aromaticity | 0.018 | ||
| GRAVY | -1.288 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.286 | ||
| sheet | 0.170 | ||