| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148009.1 | internal | 170 | 3-512(+) |
Amino Acid sequence : | |||
| ELKELSRWWSNLGLGQKLSFARDRLMENYLFVIGWAFEPKLSQSREAMTMVNCLVTTIDDIYDIYGSLDELELFTDAINRWDAEAIEQLPDYMKICFMALFNTTNLTAYRIMCSKGVNII SQLRRSWADLSKAYMTEAKWYHNGYMPTLVEYLDTAWISISGHVVLTHAY | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,836.579 | ||
| Theoretical pI: | 5.025 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53400 53525 | ||
| Instability index: | 45.215 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.176 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148009.1 | internal | 170 | 3-512(+) |
Amino Acid sequence : | |||
| ELKELSRWWSNLGLGQKLSFARDRLMENYLFVIGWAFEPKLSQSREAMTMVNCLVTTIDDIYDIYGSLDELELFTDAINRWDAEAIEQLPDYMKICFMALFNTTNLTAYRIMCSKGVNII SQLRRSWADLSKAYMTEAKWYHNGYMPTLVEYLDTAWISISGHVVLTHAY | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,836.579 | ||
| Theoretical pI: | 5.025 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53400 53525 | ||
| Instability index: | 45.215 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.176 | ||
| sheet | 0.306 | ||