| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148015.1 | internal | 190 | 572-3(-) |
Amino Acid sequence : | |||
| RHTTHKRGNNQPQDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSA LNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIVLTR | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 18,725.993 | ||
| Theoretical pI: | 8.175 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.850 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.653 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.238 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148015.1 | 5prime_partial | 164 | 1-495(+) |
Amino Acid sequence : | |||
| ARVKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFL RRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 18,725.993 | ||
| Theoretical pI: | 8.175 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.850 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.653 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.238 | ||
| sheet | 0.226 | ||