| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148037.1 | internal | 159 | 477-1(-) |
Amino Acid sequence : | |||
| DDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSM RVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGS | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 16,670.505 | ||
| Theoretical pI: | 5.579 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 50.163 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.829 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.234 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148037.1 | 5prime_partial | 145 | 2-439(+) |
Amino Acid sequence : | |||
| DPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASME NGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,670.505 | ||
| Theoretical pI: | 5.579 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 50.163 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.829 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.234 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148037.1 | internal | 159 | 477-1(-) |
Amino Acid sequence : | |||
| DDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSM RVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGS | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 16,670.505 | ||
| Theoretical pI: | 5.579 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 50.163 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.829 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.234 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148037.1 | 5prime_partial | 145 | 2-439(+) |
Amino Acid sequence : | |||
| DPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASME NGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,670.505 | ||
| Theoretical pI: | 5.579 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 50.163 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.829 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.234 | ||
| sheet | 0.241 | ||