| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148042.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
| LSPTAGDGSVVEDLGGLRAYVAGSSNSTIAIILISDIYGFESPNLRKVADRAATSGFFVVVPDFLYGDPYVPDNAERPVPVWIKSHTAAKGFEDAKSVITALKSRGVSAVGAAGYCWGAK VVAELAKSGDIQSAVMLHPSFVTVD | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,089.917 | ||
| Theoretical pI: | 5.285 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 28.683 | ||
| aromaticity | 0.090 | ||
| GRAVY | 0.246 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.276 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148042.1 | internal | 145 | 1-435(+) |
Amino Acid sequence : | |||
| LSPTAGDGSVVEDLGGLRAYVAGSSNSTIAIILISDIYGFESPNLRKVADRAATSGFFVVVPDFLYGDPYVPDNAERPVPVWIKSHTAAKGFEDAKSVITALKSRGVSAVGAAGYCWGAK VVAELAKSGDIQSAVMLHPSFVTVD | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 15,089.917 | ||
| Theoretical pI: | 5.285 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 28.683 | ||
| aromaticity | 0.090 | ||
| GRAVY | 0.246 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.276 | ||
| sheet | 0.234 | ||