| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148049.1 | internal | 120 | 1-360(+) |
Amino Acid sequence : | |||
| TQLTNEHIKGMLMNIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDAN | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,581.733 | ||
| Theoretical pI: | 7.748 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 25.408 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.203 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.175 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148049.1 | internal | 120 | 1-360(+) |
Amino Acid sequence : | |||
| TQLTNEHIKGMLMNIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDAN | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,581.733 | ||
| Theoretical pI: | 7.748 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 25.408 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.203 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.175 | ||
| sheet | 0.283 | ||