Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148050.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
EEMWNMVTGQSGGRIASTTIPVMFGRSLEVPESCNGIARFNFEYLCGRPVGAADYIAIARNYHTVFISDIPVMSMRIRDKARRFITLIDEMYNHHCCLFCLAATSIDNLFQGTEEGTLFD LESFQFETGDRNWETSTRCFSNR* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,331.337 | ||
Theoretical pI: | 5.146 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 40.234 | ||
aromaticity | 0.119 | ||
GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.224 | ||
sheet | 0.238 |