| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148054.1 | internal | 179 | 1-537(+) |
Amino Acid sequence : | |||
| VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQEASSTDKSIKLYEGFLHDLLFEPERDDIARSI | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 19,776.421 | ||
| Theoretical pI: | 6.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 36.549 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.246 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148054.1 | internal | 179 | 1-537(+) |
Amino Acid sequence : | |||
| VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQEASSTDKSIKLYEGFLHDLLFEPERDDIARSI | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 19,776.421 | ||
| Theoretical pI: | 6.472 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 36.549 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.246 | ||
| sheet | 0.235 | ||