| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148061.1 | internal | 131 | 2-394(+) |
Amino Acid sequence : | |||
| EGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHA ARVMIPARCRG | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 13,819.630 | ||
| Theoretical pI: | 6.076 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 24.382 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.237 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148061.1 | internal | 131 | 2-394(+) |
Amino Acid sequence : | |||
| EGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHA ARVMIPARCRG | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 13,819.630 | ||
| Theoretical pI: | 6.076 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 24.382 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.237 | ||
| sheet | 0.237 | ||