Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148061.1 | internal | 131 | 2-394(+) |
Amino Acid sequence : | |||
EGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHA ARVMIPARCRG | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 13,819.630 | ||
Theoretical pI: | 6.076 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 24.382 | ||
aromaticity | 0.053 | ||
GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.237 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148061.1 | internal | 131 | 2-394(+) |
Amino Acid sequence : | |||
EGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHA ARVMIPARCRG | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 13,819.630 | ||
Theoretical pI: | 6.076 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 24.382 | ||
aromaticity | 0.053 | ||
GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.237 | ||
sheet | 0.237 |