Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148065.1 | internal | 124 | 1-372(+) |
Amino Acid sequence : | |||
VNKALLLGYSILEGQEFMSDLDVQIPTAFDPFAEANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSGFLVQAGIV KKEH | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,788.502 | ||
Theoretical pI: | 6.905 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 26.482 | ||
aromaticity | 0.073 | ||
GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.210 | ||
sheet | 0.234 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148065.1 | internal | 124 | 1-372(+) |
Amino Acid sequence : | |||
VNKALLLGYSILEGQEFMSDLDVQIPTAFDPFAEANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSGFLVQAGIV KKEH | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,788.502 | ||
Theoretical pI: | 6.905 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 26.482 | ||
aromaticity | 0.073 | ||
GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.210 | ||
sheet | 0.234 |