| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148075.1 | internal | 127 | 2-382(+) |
Amino Acid sequence : | |||
| KMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIRDDKIALKLPAEDKKKIEDVIEEAILWLEANQLAEADEFDDKMKELEGICNPIIAKMYQGAGADMGAGMDEDGPAPTGGSSAG PKIEEVD | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,959.685 | ||
| Theoretical pI: | 11.829 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 38.113 | ||
| aromaticity | 0.008 | ||
| GRAVY | 0.777 | ||
Secondary Structure Fraction | |||
| Helix | 0.480 | ||
| turn | 0.197 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148075.1 | internal | 127 | 382-2(-) |
Amino Acid sequence : | |||
| VDLLNFRPSTATAGRSGTILVHAGAHISTGTLIHLRNNGVADSLKLLHLVIKLVRLRQLVRLEPQDGLLNHVLNLLLVLGRQLQCNLVVSNGVPHVVRVVLQSILGLHLLLVLLVLRLVL LRLLHHL | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,959.685 | ||
| Theoretical pI: | 11.829 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 38.113 | ||
| aromaticity | 0.008 | ||
| GRAVY | 0.777 | ||
Secondary Structure Fraction | |||
| Helix | 0.480 | ||
| turn | 0.197 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148075.1 | internal | 127 | 2-382(+) |
Amino Acid sequence : | |||
| KMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIRDDKIALKLPAEDKKKIEDVIEEAILWLEANQLAEADEFDDKMKELEGICNPIIAKMYQGAGADMGAGMDEDGPAPTGGSSAG PKIEEVD | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,959.685 | ||
| Theoretical pI: | 11.829 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 38.113 | ||
| aromaticity | 0.008 | ||
| GRAVY | 0.777 | ||
Secondary Structure Fraction | |||
| Helix | 0.480 | ||
| turn | 0.197 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148075.1 | internal | 127 | 382-2(-) |
Amino Acid sequence : | |||
| VDLLNFRPSTATAGRSGTILVHAGAHISTGTLIHLRNNGVADSLKLLHLVIKLVRLRQLVRLEPQDGLLNHVLNLLLVLGRQLQCNLVVSNGVPHVVRVVLQSILGLHLLLVLLVLRLVL LRLLHHL | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,959.685 | ||
| Theoretical pI: | 11.829 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 38.113 | ||
| aromaticity | 0.008 | ||
| GRAVY | 0.777 | ||
Secondary Structure Fraction | |||
| Helix | 0.480 | ||
| turn | 0.197 | ||
| sheet | 0.339 | ||