Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148075.1 | internal | 127 | 2-382(+) |
Amino Acid sequence : | |||
KMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIRDDKIALKLPAEDKKKIEDVIEEAILWLEANQLAEADEFDDKMKELEGICNPIIAKMYQGAGADMGAGMDEDGPAPTGGSSAG PKIEEVD | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,959.685 | ||
Theoretical pI: | 11.829 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 38.113 | ||
aromaticity | 0.008 | ||
GRAVY | 0.777 | ||
Secondary Structure Fraction | |||
Helix | 0.480 | ||
turn | 0.197 | ||
sheet | 0.339 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148075.1 | internal | 127 | 382-2(-) |
Amino Acid sequence : | |||
VDLLNFRPSTATAGRSGTILVHAGAHISTGTLIHLRNNGVADSLKLLHLVIKLVRLRQLVRLEPQDGLLNHVLNLLLVLGRQLQCNLVVSNGVPHVVRVVLQSILGLHLLLVLLVLRLVL LRLLHHL | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,959.685 | ||
Theoretical pI: | 11.829 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 38.113 | ||
aromaticity | 0.008 | ||
GRAVY | 0.777 | ||
Secondary Structure Fraction | |||
Helix | 0.480 | ||
turn | 0.197 | ||
sheet | 0.339 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148075.1 | internal | 127 | 2-382(+) |
Amino Acid sequence : | |||
KMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIRDDKIALKLPAEDKKKIEDVIEEAILWLEANQLAEADEFDDKMKELEGICNPIIAKMYQGAGADMGAGMDEDGPAPTGGSSAG PKIEEVD | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,959.685 | ||
Theoretical pI: | 11.829 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 38.113 | ||
aromaticity | 0.008 | ||
GRAVY | 0.777 | ||
Secondary Structure Fraction | |||
Helix | 0.480 | ||
turn | 0.197 | ||
sheet | 0.339 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148075.1 | internal | 127 | 382-2(-) |
Amino Acid sequence : | |||
VDLLNFRPSTATAGRSGTILVHAGAHISTGTLIHLRNNGVADSLKLLHLVIKLVRLRQLVRLEPQDGLLNHVLNLLLVLGRQLQCNLVVSNGVPHVVRVVLQSILGLHLLLVLLVLRLVL LRLLHHL | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,959.685 | ||
Theoretical pI: | 11.829 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 38.113 | ||
aromaticity | 0.008 | ||
GRAVY | 0.777 | ||
Secondary Structure Fraction | |||
Helix | 0.480 | ||
turn | 0.197 | ||
sheet | 0.339 |