| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148078.1 | 5prime_partial | 115 | 1-348(+) |
Amino Acid sequence : | |||
| AFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSIIPQPQDNQQVVGPCLYTVQIHTSCLSPPKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQHSGSVRYR* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 10,344.518 | ||
| Theoretical pI: | 8.578 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 27.514 | ||
| aromaticity | 0.069 | ||
| GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.297 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148078.1 | 5prime_partial | 101 | 529-224(-) |
Amino Acid sequence : | |||
| GRGGDLSSAAVETAPYVIRKNAVKFEHAAATVATVELPYRYSIGSPAVVPVSAQIQVANTISGTARTLNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,344.518 | ||
| Theoretical pI: | 8.578 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 27.514 | ||
| aromaticity | 0.069 | ||
| GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.297 | ||
| sheet | 0.228 | ||