| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148083.1 | internal | 136 | 1-408(+) |
Amino Acid sequence : | |||
| NCLGWAARDASGTLSPHKFDRRVTGSDDVSIKITHCGVCYADVAWTQNRMRDSIYPLVPGHEIVGVVTEIGSSVSHFKIGDNIGVGTYVNSCRDCEYCNEYIENHCSNGGVVLTFNGKDS DGTVTKGGYSSYIVVH | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,724.211 | ||
| Theoretical pI: | 5.796 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
| Instability index: | 28.500 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.212 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.294 | ||
| sheet | 0.110 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148083.1 | internal | 136 | 1-408(+) |
Amino Acid sequence : | |||
| NCLGWAARDASGTLSPHKFDRRVTGSDDVSIKITHCGVCYADVAWTQNRMRDSIYPLVPGHEIVGVVTEIGSSVSHFKIGDNIGVGTYVNSCRDCEYCNEYIENHCSNGGVVLTFNGKDS DGTVTKGGYSSYIVVH | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,724.211 | ||
| Theoretical pI: | 5.796 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
| Instability index: | 28.500 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.212 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.294 | ||
| sheet | 0.110 | ||