Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148089.1 | internal | 150 | 3-452(+) |
Amino Acid sequence : | |||
GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTESDITCTAEEL VKSVEEHPSQVVVGDLLDASNDALPHPQPT | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,136.591 | ||
Theoretical pI: | 4.320 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 39.235 | ||
aromaticity | 0.067 | ||
GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.327 | ||
sheet | 0.207 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148089.1 | internal | 150 | 3-452(+) |
Amino Acid sequence : | |||
GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTESDITCTAEEL VKSVEEHPSQVVVGDLLDASNDALPHPQPT | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,136.591 | ||
Theoretical pI: | 4.320 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 39.235 | ||
aromaticity | 0.067 | ||
GRAVY | -0.387 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.327 | ||
sheet | 0.207 |