| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148111.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
| SSDGRFEFLIKKVAGSTAELLCGLGRGDVVEITGVMGNGFQVGRISPPDNYPTVLIFATGSGISPIRSLIESGFYANKRSDVRLYYGARNLERMAYQDRFKDWEATGVRIVPVLSRPDDR WKGEHGYIQAVFTKAKQIIN | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,547.529 | ||
| Theoretical pI: | 9.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 40.201 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.264 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148111.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
| SSDGRFEFLIKKVAGSTAELLCGLGRGDVVEITGVMGNGFQVGRISPPDNYPTVLIFATGSGISPIRSLIESGFYANKRSDVRLYYGARNLERMAYQDRFKDWEATGVRIVPVLSRPDDR WKGEHGYIQAVFTKAKQIIN | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,547.529 | ||
| Theoretical pI: | 9.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 40.201 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.264 | ||
| sheet | 0.193 | ||