Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148111.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
SSDGRFEFLIKKVAGSTAELLCGLGRGDVVEITGVMGNGFQVGRISPPDNYPTVLIFATGSGISPIRSLIESGFYANKRSDVRLYYGARNLERMAYQDRFKDWEATGVRIVPVLSRPDDR WKGEHGYIQAVFTKAKQIIN | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,547.529 | ||
Theoretical pI: | 9.332 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 40.201 | ||
aromaticity | 0.107 | ||
GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.264 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148111.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
SSDGRFEFLIKKVAGSTAELLCGLGRGDVVEITGVMGNGFQVGRISPPDNYPTVLIFATGSGISPIRSLIESGFYANKRSDVRLYYGARNLERMAYQDRFKDWEATGVRIVPVLSRPDDR WKGEHGYIQAVFTKAKQIIN | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,547.529 | ||
Theoretical pI: | 9.332 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 40.201 | ||
aromaticity | 0.107 | ||
GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.264 | ||
sheet | 0.193 |