Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148129.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
LVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENA KVEEVRASMENGVLTVTVP | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 13,822.022 | ||
Theoretical pI: | 9.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 61.685 | ||
aromaticity | 0.016 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.242 | ||
sheet | 0.355 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148129.1 | internal | 139 | 419-3(-) |
Amino Acid sequence : | |||
FGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGS QRSKDDEGSNTREPNPNGT | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 13,822.022 | ||
Theoretical pI: | 9.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 61.685 | ||
aromaticity | 0.016 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.242 | ||
sheet | 0.355 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148129.1 | 5prime_partial | 124 | 417-43(-) |
Amino Acid sequence : | |||
RHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIP EIEG* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,822.022 | ||
Theoretical pI: | 9.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 61.685 | ||
aromaticity | 0.016 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.242 | ||
sheet | 0.355 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148129.1 | internal | 139 | 1-417(+) |
Amino Acid sequence : | |||
LVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENA KVEEVRASMENGVLTVTVP | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 13,822.022 | ||
Theoretical pI: | 9.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 61.685 | ||
aromaticity | 0.016 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.242 | ||
sheet | 0.355 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148129.1 | internal | 139 | 419-3(-) |
Amino Acid sequence : | |||
FGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGS QRSKDDEGSNTREPNPNGT | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 13,822.022 | ||
Theoretical pI: | 9.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 61.685 | ||
aromaticity | 0.016 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.242 | ||
sheet | 0.355 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148129.1 | 5prime_partial | 124 | 417-43(-) |
Amino Acid sequence : | |||
RHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIP EIEG* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,822.022 | ||
Theoretical pI: | 9.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 61.685 | ||
aromaticity | 0.016 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.242 | ||
sheet | 0.355 |