| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148134.1 | internal | 132 | 3-398(+) |
Amino Acid sequence : | |||
| CLGWAARDASGTLSPHKFDRRVTGSDDVSIKITHCGVCYADVAWTQNRMRDSIYPLVPGHEIVGVVTEIGSSVSHFKIGDNIGVGTYVNSCRDCENCNEYIENHCSKGGLVLTFNGKDSD GTVTKGGYSSYI | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,253.733 | ||
| Theoretical pI: | 5.904 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 30.199 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.295 | ||
| sheet | 0.121 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148134.1 | internal | 132 | 3-398(+) |
Amino Acid sequence : | |||
| CLGWAARDASGTLSPHKFDRRVTGSDDVSIKITHCGVCYADVAWTQNRMRDSIYPLVPGHEIVGVVTEIGSSVSHFKIGDNIGVGTYVNSCRDCENCNEYIENHCSKGGLVLTFNGKDSD GTVTKGGYSSYI | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,253.733 | ||
| Theoretical pI: | 5.904 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 30.199 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.295 | ||
| sheet | 0.121 | ||