| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148140.1 | internal | 139 | 2-418(+) |
Amino Acid sequence : | |||
| PHHECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVE HSGQGACRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,343.583 | ||
| Theoretical pI: | 8.712 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 37.589 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.295 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148140.1 | internal | 139 | 3-419(+) |
Amino Acid sequence : | |||
| PTMNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELS TQDKELAGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,343.583 | ||
| Theoretical pI: | 8.712 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 37.589 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.295 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148140.1 | internal | 139 | 2-418(+) |
Amino Acid sequence : | |||
| PHHECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVE HSGQGACRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,343.583 | ||
| Theoretical pI: | 8.712 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 37.589 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.295 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148140.1 | internal | 139 | 3-419(+) |
Amino Acid sequence : | |||
| PTMNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELS TQDKELAGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,343.583 | ||
| Theoretical pI: | 8.712 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 37.589 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.295 | ||
| sheet | 0.331 | ||