| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148141.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
| KHNLRTESLKQQYNLVKTRTAGDDKSGSLGSHVMQYGKLELSVEDLYLYMGSNPANDNSTFIADNSLPSFSRAVNQRDADLVYYWHKFQRSPQGSQEKHGAQRDLLDVMSHRLHIDNSVE LIVKLLFGSEKGMEVLKAVRPAGQPL | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,474.351 | ||
| Theoretical pI: | 8.152 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 42.689 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.627 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.260 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148141.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
| KHNLRTESLKQQYNLVKTRTAGDDKSGSLGSHVMQYGKLELSVEDLYLYMGSNPANDNSTFIADNSLPSFSRAVNQRDADLVYYWHKFQRSPQGSQEKHGAQRDLLDVMSHRLHIDNSVE LIVKLLFGSEKGMEVLKAVRPAGQPL | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,474.351 | ||
| Theoretical pI: | 8.152 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 42.689 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.627 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.260 | ||
| sheet | 0.253 | ||