| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148150.1 | internal | 135 | 3-407(+) |
Amino Acid sequence : | |||
| FGRIGRLVARVALQSPDVELVAVNDPFITTDYMTYMFKYDSVHGKWKHHEITVKDSKTLLFGEKAVTVFGFRNPEEIPWGETGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDA PMFVVGVNEKSYTSD | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,914.799 | ||
| Theoretical pI: | 6.476 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 30.101 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.217 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.207 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148150.1 | internal | 135 | 3-407(+) |
Amino Acid sequence : | |||
| FGRIGRLVARVALQSPDVELVAVNDPFITTDYMTYMFKYDSVHGKWKHHEITVKDSKTLLFGEKAVTVFGFRNPEEIPWGETGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDA PMFVVGVNEKSYTSD | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,914.799 | ||
| Theoretical pI: | 6.476 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 30.101 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.217 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.207 | ||
| sheet | 0.207 | ||