Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148152.1 | internal | 131 | 1-393(+) |
Amino Acid sequence : | |||
FDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFADTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASM ENGVLTVTVPK | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,516.841 | ||
Theoretical pI: | 9.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.746 | ||
aromaticity | 0.015 | ||
GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.244 | ||
sheet | 0.351 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148152.1 | internal | 131 | 395-3(-) |
Amino Acid sequence : | |||
AFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVSANAEVSLGKFKLFARGTTSRKKLSM GSQRSKDEEGS | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,516.841 | ||
Theoretical pI: | 9.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.746 | ||
aromaticity | 0.015 | ||
GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.244 | ||
sheet | 0.351 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148152.1 | internal | 131 | 393-1(-) |
Amino Acid sequence : | |||
LRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDG IPEIEGRGGIE | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,516.841 | ||
Theoretical pI: | 9.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.746 | ||
aromaticity | 0.015 | ||
GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.244 | ||
sheet | 0.351 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148152.1 | internal | 131 | 1-393(+) |
Amino Acid sequence : | |||
FDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFADTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASM ENGVLTVTVPK | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,516.841 | ||
Theoretical pI: | 9.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.746 | ||
aromaticity | 0.015 | ||
GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.244 | ||
sheet | 0.351 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148152.1 | internal | 131 | 395-3(-) |
Amino Acid sequence : | |||
AFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVSANAEVSLGKFKLFARGTTSRKKLSM GSQRSKDEEGS | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,516.841 | ||
Theoretical pI: | 9.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.746 | ||
aromaticity | 0.015 | ||
GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.244 | ||
sheet | 0.351 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148152.1 | internal | 131 | 393-1(-) |
Amino Acid sequence : | |||
LRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDG IPEIEGRGGIE | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,516.841 | ||
Theoretical pI: | 9.506 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.746 | ||
aromaticity | 0.015 | ||
GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.244 | ||
sheet | 0.351 |