Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148152.1	internal	131	1-393(+)
Amino Acid sequence :
FDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFADTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASM ENGVLTVTVPK
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,516.841
Theoretical pI:		9.506
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		62.746
aromaticity		0.015
GRAVY		-0.059
Secondary Structure Fraction
Helix		0.359
turn		0.244
sheet		0.351

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148152.1	internal	131	395-3(-)
Amino Acid sequence :
AFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVSANAEVSLGKFKLFARGTTSRKKLSM GSQRSKDEEGS
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,516.841
Theoretical pI:		9.506
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		62.746
aromaticity		0.015
GRAVY		-0.059
Secondary Structure Fraction
Helix		0.359
turn		0.244
sheet		0.351

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148152.1	internal	131	393-1(-)
Amino Acid sequence :
LRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDG IPEIEGRGGIE
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,516.841
Theoretical pI:		9.506
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		62.746
aromaticity		0.015
GRAVY		-0.059
Secondary Structure Fraction
Helix		0.359
turn		0.244
sheet		0.351

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148152.1	internal	131	1-393(+)
Amino Acid sequence :
FDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFADTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPENAKVEEVRASM ENGVLTVTVPK
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,516.841
Theoretical pI:		9.506
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		62.746
aromaticity		0.015
GRAVY		-0.059
Secondary Structure Fraction
Helix		0.359
turn		0.244
sheet		0.351

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148152.1	internal	131	395-3(-)
Amino Acid sequence :
AFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVSANAEVSLGKFKLFARGTTSRKKLSM GSQRSKDEEGS
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,516.841
Theoretical pI:		9.506
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		62.746
aromaticity		0.015
GRAVY		-0.059
Secondary Structure Fraction
Helix		0.359
turn		0.244
sheet		0.351

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX148152.1	internal	131	393-1(-)
Amino Acid sequence :
LRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDG IPEIEGRGGIE
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,516.841
Theoretical pI:		9.506
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		62.746
aromaticity		0.015
GRAVY		-0.059
Secondary Structure Fraction
Helix		0.359
turn		0.244
sheet		0.351