| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148155.1 | 5prime_partial | 150 | 2-454(+) |
Amino Acid sequence : | |||
| NGMKPDGTLEASMLQASEVWPGVTYALAATMIQEGMVETAFKTAQGVYEAAWSRNGLGYSFQVPEAWNGNDQYRALNYMRPLSIWAMQWALSPPKLHKEEQRADDRGNSSLHNMEFSKIA EMLKLPEENTSRTSLGILYDIIREKFFPRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,994.064 | ||
| Theoretical pI: | 5.429 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
| Instability index: | 28.473 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.247 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148155.1 | 5prime_partial | 150 | 2-454(+) |
Amino Acid sequence : | |||
| NGMKPDGTLEASMLQASEVWPGVTYALAATMIQEGMVETAFKTAQGVYEAAWSRNGLGYSFQVPEAWNGNDQYRALNYMRPLSIWAMQWALSPPKLHKEEQRADDRGNSSLHNMEFSKIA EMLKLPEENTSRTSLGILYDIIREKFFPRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,994.064 | ||
| Theoretical pI: | 5.429 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
| Instability index: | 28.473 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.247 | ||
| sheet | 0.333 | ||