| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148172.1 | internal | 101 | 2-304(+) |
Amino Acid sequence : | |||
| SLAPGSGVVTKYLLKSGLQKYLNHQGFHIVGYGCTTCIGNSGDLDESVSAAISENDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGSVDIDF | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,524.736 | ||
| Theoretical pI: | 5.781 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 24.678 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.204 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.307 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148172.1 | internal | 101 | 2-304(+) |
Amino Acid sequence : | |||
| SLAPGSGVVTKYLLKSGLQKYLNHQGFHIVGYGCTTCIGNSGDLDESVSAAISENDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGSVDIDF | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,524.736 | ||
| Theoretical pI: | 5.781 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 24.678 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.204 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.307 | ||
| sheet | 0.248 | ||