| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148175.1 | 5prime_partial | 167 | 2-505(+) |
Amino Acid sequence : | |||
| HEPKPICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREGTGWLWMIMERLKVGNAKIEEIDMLQEITKQIEGHTICALGDAAAWPVQGLDQAFQAG AREEDSGASREGAVAGCSSLSINHLQIYVLVFFICYVLKIMGGSLQK* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 16,238.753 | ||
| Theoretical pI: | 9.049 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 57.237 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.229 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148175.1 | 3prime_partial | 144 | 433-2(-) |
Amino Acid sequence : | |||
| MIDTQAAATCNSSLSARSRILLSSSGLKCLIQSLDWPSSSIPERTNGVPLDLLCDLLKHINLLNLRIPNLQPLHDHPEPTRPLPTRCALTTALVLVEVRQPRDRIHHIGRLVHHNNRCRA QSRLDCLECIVIHQHIVTYGFRLV | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,238.753 | ||
| Theoretical pI: | 9.049 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 57.237 | ||
| aromaticity | 0.021 | ||
| GRAVY | -0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.229 | ||
| sheet | 0.250 | ||