Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148175.1 | 5prime_partial | 167 | 2-505(+) |
Amino Acid sequence : | |||
HEPKPICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHESCGQCTPCREGTGWLWMIMERLKVGNAKIEEIDMLQEITKQIEGHTICALGDAAAWPVQGLDQAFQAG AREEDSGASREGAVAGCSSLSINHLQIYVLVFFICYVLKIMGGSLQK* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 16,238.753 | ||
Theoretical pI: | 9.049 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 57.237 | ||
aromaticity | 0.021 | ||
GRAVY | -0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.229 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148175.1 | 3prime_partial | 144 | 433-2(-) |
Amino Acid sequence : | |||
MIDTQAAATCNSSLSARSRILLSSSGLKCLIQSLDWPSSSIPERTNGVPLDLLCDLLKHINLLNLRIPNLQPLHDHPEPTRPLPTRCALTTALVLVEVRQPRDRIHHIGRLVHHNNRCRA QSRLDCLECIVIHQHIVTYGFRLV | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,238.753 | ||
Theoretical pI: | 9.049 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 57.237 | ||
aromaticity | 0.021 | ||
GRAVY | -0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.229 | ||
sheet | 0.250 |