| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148203.1 | internal | 161 | 3-485(+) |
Amino Acid sequence : | |||
| TSLRMELDIQRFIQNCDQQQFEFPHLPTSYLRCAAHRVAQHYGLQTMGLDNAIDGSGSRVIARKTPESRFPAVCLSYIPTKQHEKENNENIKFVIRPRPSKGSFGDGSESGTRASPIITV EERKEEYDKARARIFTHPPSPELEGPSSIDASDGRTVCSNR | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 18,105.034 | ||
| Theoretical pI: | 7.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 53.708 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.772 | ||
Secondary Structure Fraction | |||
| Helix | 0.224 | ||
| turn | 0.273 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX148203.1 | internal | 161 | 3-485(+) |
Amino Acid sequence : | |||
| TSLRMELDIQRFIQNCDQQQFEFPHLPTSYLRCAAHRVAQHYGLQTMGLDNAIDGSGSRVIARKTPESRFPAVCLSYIPTKQHEKENNENIKFVIRPRPSKGSFGDGSESGTRASPIITV EERKEEYDKARARIFTHPPSPELEGPSSIDASDGRTVCSNR | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 18,105.034 | ||
| Theoretical pI: | 7.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
| Instability index: | 53.708 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.772 | ||
Secondary Structure Fraction | |||
| Helix | 0.224 | ||
| turn | 0.273 | ||
| sheet | 0.205 | ||