Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148212.1 | 5prime_partial | 180 | 1-543(+) |
Amino Acid sequence : | |||
DPPGCRNSAPEKTKSLEMDFRVMGLDAPMLSALHHLMEDVSGSDSSLEKEKATGPTRSYVRDATAMAYTPLDIKELPDSYVFLVDMPGVKSGEIGVQVEDDNLLVITGERKREDDKDQHH KYLRMERRMGKFMRKFSLPENVDTENGISAICQDGVLTVTVQKKPPPEPKKPKTIEVKIA* | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 20,129.820 | ||
Theoretical pI: | 5.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 35.011 | ||
aromaticity | 0.044 | ||
GRAVY | -0.646 | ||
Secondary Structure Fraction | |||
Helix | 0.239 | ||
turn | 0.228 | ||
sheet | 0.261 |