Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148216.1 | 5prime_partial | 137 | 421-8(-) |
Amino Acid sequence : | |||
CDFSSIHCIWQILFVSKHKQNSIPQLILIEHPVELIPGLHNTISVIAVNNKDKTLGVLKVVPPQRSDLILTPHIPNSETNVLVFHSLHIKSDGGYRGDDLTELELVEDGGLTGSIETNHQ DPHLLLRKETAKQLRKS* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 12,140.396 | ||
Theoretical pI: | 10.663 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
Instability index: | 64.284 | ||
aromaticity | 0.074 | ||
GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.306 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148216.1 | complete | 108 | 78-404(+) |
Amino Acid sequence : | |||
MLPVRPPSSTSSSSVRSSPRYPPSDLMWRLWNTRTLVSLFGMWGVRIRSDLCGGTTFRTPKVLSLLLTAMTEIVLWRPGMSSTGCSMRMSCGMLFCLCLLTNRICQMQ* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,140.396 | ||
Theoretical pI: | 10.663 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
Instability index: | 64.284 | ||
aromaticity | 0.074 | ||
GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.306 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148216.1 | 5prime_partial | 137 | 421-8(-) |
Amino Acid sequence : | |||
CDFSSIHCIWQILFVSKHKQNSIPQLILIEHPVELIPGLHNTISVIAVNNKDKTLGVLKVVPPQRSDLILTPHIPNSETNVLVFHSLHIKSDGGYRGDDLTELELVEDGGLTGSIETNHQ DPHLLLRKETAKQLRKS* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 12,140.396 | ||
Theoretical pI: | 10.663 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
Instability index: | 64.284 | ||
aromaticity | 0.074 | ||
GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.306 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX148216.1 | complete | 108 | 78-404(+) |
Amino Acid sequence : | |||
MLPVRPPSSTSSSSVRSSPRYPPSDLMWRLWNTRTLVSLFGMWGVRIRSDLCGGTTFRTPKVLSLLLTAMTEIVLWRPGMSSTGCSMRMSCGMLFCLCLLTNRICQMQ* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,140.396 | ||
Theoretical pI: | 10.663 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
Instability index: | 64.284 | ||
aromaticity | 0.074 | ||
GRAVY | 0.183 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.306 | ||
sheet | 0.241 |